PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G032000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 478aa    MW: 51970.1 Da    PI: 7.7527
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G032000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.6e-18195242148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+WT++Ed llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sobic.009G032000.1.p 195 RGPWTADEDILLVNYIAVHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 242
                           89********************************************97 PP

2Myb_DNA-binding52.98.7e-17248291146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Sobic.009G032000.1.p 248 RGNITAEEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 291
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.504190242IPR017930Myb domain
SuperFamilySSF466892.28E-30192289IPR009057Homeodomain-like
SMARTSM007178.0E-15194244IPR001005SANT/Myb domain
PfamPF002494.7E-16195242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-22196249IPR009057Homeodomain-like
CDDcd001673.28E-12197242No hitNo description
PROSITE profilePS5129423.447243297IPR017930Myb domain
SMARTSM007175.2E-15247295IPR001005SANT/Myb domain
PfamPF002495.0E-15248291IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-23250295IPR009057Homeodomain-like
CDDcd001673.54E-12252291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MDTGARRRRR RRRQRSELAT CFISLLRSNC LVRRVGDTRT RTRAHSDPSI VVLTSSSAGS  60
SSYINPSSSS RSPTIPSLSV CVDPPPQLPL HHRPPSFSSS STIYYLKKLA RAHTPQLIEL  120
THHHHLIRDS DPPLASMDDM DMAMAMVSFD DLDQVLAMSP SSSATSSAPV AAAQPAAAGS  180
SSDDEAAAIC ADLRRGPWTA DEDILLVNYI AVHGEGRWNS LARSAGLKRT GKSCRLRWLN  240
YLRPDVRRGN ITAEEQLLIL DLHSRWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKHARHL  300
RCDVNSASFR HVVRHVWMPR LRERVQAAAG RDAGEGCGGG VQSPAAAPLV PVVVEAPAAT  360
TTASAPSACY DYYDASSALR RPSSSTLTAD DTSHDYAGVY AYTSAAAATP TNDNQGCRQM  420
TTDDDVFAGT ALSELLATSG RDDDSSSASM IGLPEFGFGD LEDGLWSLDD LCLQQLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-2619229524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1512RRRRRRRR
2612RRRRRRR
3714RRRRRRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277111e-178KJ727711.1 Zea mays clone pUT5650 MYB transcription factor (MYB101) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440535.10.0hypothetical protein SORBIDRAFT_09g002680
TrEMBLC5YZH90.0C5YZH9_SORBI; Putative uncharacterized protein Sb09g002680
STRINGSb09g002680.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP1558624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-76myb domain protein 112